PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v2264060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WOX
Protein Properties Length: 270aa    MW: 30990.5 Da    PI: 5.4316
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v2264060.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.73e-2194154257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      r+R+++t+ ql++Le+ F + n +p++e+++e+A+ l    +++e++V++WFqNrRa+ k+
  Lj5g3v2264060.1  94 RQRWNPTPIQLQILESIFDQgNGTPNKEKIKEIAADLvqhgQVSETNVYNWFQNRRARSKR 154
                      89*****************99**************************************97 PP

2Wus_type_Homeobox99.72.2e-3293155264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +r+RW+Ptp Q++iLe+++++G  tPnke+i++i+a L ++G+++++NV++WFQNr+aR+++k
    Lj5g3v2264060.1  93 SRQRWNPTPIQLQILESIFDQGNGTPNKEKIKEIAADLVQHGQVSETNVYNWFQNRRARSKRK 155
                        789***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.85E-1887156IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-1787157IPR009057Homeodomain-like
PROSITE profilePS5007114.99790155IPR001356Homeobox domain
SMARTSM003897.6E-1392159IPR001356Homeobox domain
PfamPF000464.4E-1994154IPR001356Homeobox domain
CDDcd000861.94E-1394155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MVNLMEWKDQ LQMWQQQNGN VNVGVQREMM YVKVMTDEQL ETLRKQIAVY ATICEQLIEM  60
HRTFSTQQDL AGVRLGNIYF DPLMTSSGHK LTSRQRWNPT PIQLQILESI FDQGNGTPNK  120
EKIKEIAADL VQHGQVSETN VYNWFQNRRA RSKRKLQNVA PSTTESEADT EVDSKDRKTK  180
PEEFYSQQNN VTTEVDLQCL NDSGSNNKPY SMFPSDGSLS STRKLSHVPV FDGVLSNSRS  240
DYQTGKMGED ESYNLYKQAG DYNMEGRYLG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0060990.0AP006099.1 Lotus japonicus genomic DNA, chromosome 5, clone: LjT03D07, TM0180a, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014512537.11e-138PREDICTED: WUSCHEL-related homeobox 8-like isoform X1
SwissprotO817882e-81WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLA0A0L9U1781e-139A0A0L9U178_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SL911e-139A0A0S3SL91_PHAAN; Uncharacterized protein
STRINGGLYMA10G43580.21e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18553493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.15e-81WUSCHEL related homeobox 13